Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14324
    • SpeciesHuman
    • SequenceVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKA LYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
    • Molecular weight37 kDa including tags
    • Amino acids320 to 419

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (2E
    • (2E,6E) farnesyl diphosphate synthase
    • 6E)-farnesyl diphosphate synthase
    • Dimethylallyltranstransferase
    • Farnesyl diphosphate synthase
    • Farnesyl diphosphate synthetase
    • Farnesyl pyrophosphate synthase
    • Farnesyl pyrophosphate synthetase
    • Fdps
    • FPP synthase
    • FPP synthetase
    • FPPS
    • FPPS_HUMAN
    • FPS
    • Geranyltranstransferase
    see all
  • FunctionKey enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate.
  • PathwayIsoprenoid biosynthesis; farnesyl diphosphate biosynthesis; farnesyl diphosphate from geranyl diphosphate and isopentenyl diphosphate: step 1/1.
    Isoprenoid biosynthesis; geranyl diphosphate biosynthesis; geranyl diphosphate from dimethylallyl diphosphate and isopentenyl diphosphate: step 1/1.
  • Sequence similaritiesBelongs to the FPP/GGPP synthase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human FDPS protein images

  • ab114789 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human FDPS protein (ab114789)

ab114789 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"