Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00213-2
    • SpeciesHuman
    • SequenceMSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDL RSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEAS QEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGE EKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFE TDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISI RVWGVGRDSGRDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKI MAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVP VAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQA ACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKP KRLGAHTP
    • Molecular weight104 kDa including tags
    • Amino acids1 to 708

Specifications

Our Abpromise guarantee covers the use of ab114659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adaptor protein FE65a2
    • Amyloid beta (A4) precursor protein binding family B member 1
    • Amyloid beta A4 precursor protein binding family B
    • Amyloid beta A4 precursor protein binding family B member 1
    • Amyloid beta A4 precursor protein-binding family B member 1
    • Amyloid beta precursor protein binding family B member 1
    • APBB 1
    • APBB1
    • APBB1_HUMAN
    • FE 65
    • Fe65 protein
    • Protein Fe65
    • RIR
    • stat like protein
    see all
  • FunctionTranscription coregulator that can have both coactivator and corepressor functions. Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).
  • Tissue specificityHighly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.
  • Sequence similaritiesContains 2 PID domains.
    Contains 1 WW domain.
  • Post-translational
    modifications
    Phosphorylated following nuclear translocation. Phosphorylation at Tyr-546 enhances the transcription activation activity and reduces the affinity with RASD1/DEXRAS1.
  • Cellular localizationCell membrane. Cytoplasm. Nucleus. Cell projection > growth cone. Colocalizes with TSHZ3 in axonal growth cone (By similarity). In normal conditions, it mainly localizes to the cytoplasm, while a small fraction is tethered to the cell membrane via its interaction with APP. Following exposure to DNA damaging agents, it is released from cell membrane and translocates to the nucleus. Nuclear translocation is under the regulation of APP. Colocalizes with TSHZ3 in the nucleus.
  • Information by UniProt

Recombinant Human FE65 protein images

  • SDS-PAGE analysis of ab114659 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human FE65 protein (ab114659)

ab114659 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"