Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETA QHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMT LPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDEL SPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTG SSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPL EKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLV WQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDI EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLT LSCPLCVNPVCRETKSFFTSQQL
    • Amino acids
      1 to 423
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPP
    • FCE
    • Fch
    • Fcl
    • fech
    • Ferrochelatase
    • Ferrochelatase (protoporphyria)
    • Ferrochelatase mitochondrial
    • Heme synthase
    • Heme synthetase
    • HEMH_HUMAN
    • mitochondrial
    • Protoheme ferro lyase
    • Protoheme ferro-lyase
    • Protoporphyria
    see all
  • Function
    Catalyzes the ferrous insertion into protoporphyrin IX.
  • Pathway
    Porphyrin metabolism; protoheme biosynthesis; protoheme from protoporphyrin-IX: step 1/1.
  • Involvement in disease
    Erythropoietic protoporphyria (EPP) [MIM:177000]: A form of porphyria. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. Erythropoietic protoporphyria is marked by excessive protoporphyrin in erythrocytes, plasma, liver and feces, and by widely varying photosensitive skin changes ranging from a burning or pruritic sensation to erythema, edema and wheals. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the ferrochelatase family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab158429 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up