Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHH MSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLS KLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSA QAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHH HQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA AAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRER VQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVL LLQDDRHSTSSSEQEREGGRTPTLEILKSHISGIFRPKFSLPPPLQLIPE VQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGL PRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVP KDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRT EGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKIS DFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILL WETFSLGASPYPNLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCWAYE PGQRPSFSTIYQELQSIRKRHR
    • Amino acids
      1 to 822
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c-fes/fps protein
    • cFES
    • Feline sarcoma (Snyder Theilen) viral (v fes)/Fujinami avian sarcoma (PRCII) viral (v fps) oncogene homolog
    • feline sarcoma (Snyder-Theilen) viral (v-fes)/Fujinami
    • Feline sarcoma oncogene
    • Feline sarcoma/Fujinami avian sarcoma oncogene homolog
    • fes
    • FES proto oncogene, tyrosine kinase
    • FES_HUMAN
    • FPS
    • Oncogene FES
    • Oncogene FES feline sarcoma virus
    • P93c fes
    • Proto oncogene tyrosine protein kinase Fes/Fps
    • Proto-oncogene c-Fes
    • Proto-oncogene c-Fps
    • proto-oncogene tyrosine-protein kinase Fes/Fps
    • Tyrosine-protein kinase Fes/Fps
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
    Contains 1 FCH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Information by UniProt

Images

  • ab158431 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up