Recombinant Human Fetuin A protein (ab157872)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKV WPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQL LKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAAL AAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAK CNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAV PTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRH TFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
    • Amino acids
      19 to 367
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 59 kDa bone sialic acid containing protein
    • A2HS
    • Aa2 066
    • AHS
    • Ahsg
    • Alpha 2 HS glycoprotein
    • Alpha 2 HS glycoprotein chain A
    • Alpha 2 HS glycoprotein chain B
    • Alpha 2 Z globulin
    • Alpha 2HS glycoprotein
    • Alpha-2-HS-glycoprotein chain B
    • Alpha-2-Z-globulin
    • alpha2 Heremans Schmid glycoprotein
    • Asialofetuin
    • Ba alpha 2 glycoprotein
    • Ba-alpha-2-glycoprotein
    • BSP
    • Countertrypin
    • FETUA
    • FETUA_HUMAN
    • Fetuin A
    • Fetuin, mouse, homolog of
    • Fetuin-A
    • FetuinA
    • Glycoprotein PP63
    • HSGA
    • pp63
    see all
  • Function
    Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
  • Tissue specificity
    Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
  • Sequence similarities
    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-A-type domains.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab157872 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up