Recombinant Human Fetuin B protein (ab151679)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLN RVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYG QCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNH QVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESP CTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATG SENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNS QEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKART AECPGPAQNASPLVLPPVDHHHHHH
    • Molecular weight
      42 kDa including tags
    • Amino acids
      16 to 382
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151679 is more than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names
    • 16G2
    • 2310011O17Rik
    • AI255764
    • D17980
    • Fet
    • Fetub
    • FETUB_HUMAN
    • Fetuin beta
    • Fetuin-B
    • Fetuin-like protein
    • Fetuin-like protein IRL685
    • Gugu
    • IRL685
    • Pp63
    see all
  • Tissue specificity
    Liver and testis.
  • Sequence similarities
    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-B-type domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up