Overview

  • Product name
    Recombinant Human FGF11 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGP EPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH
    • Amino acids
      15 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FGF 11
    • FGF-11
    • FGF11
    • FGF11_HUMAN
    • FHF 3
    • FHF-3
    • FHF3
    • Fibroblast growth factor 11
    • Fibroblast growth factor homologous factor 3
    • FLJ16061
    • MGC102953
    • MGC45269
    see all
  • Function
    Probably involved in nervous system development and function.
  • Tissue specificity
    Nervous system.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Information by UniProt

Images

  • ab158434 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up