Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVK LFGSKKRRRRRPEPQLKGIATKLYSRQGYHLQLQADGTIDGTKDEDSTYT LFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFEN YYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST
    • Molecular weight
      53 kDa including tags
    • Amino acids
      1 to 245

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FGF 13
    • FGF 2
    • FGF-13
    • FGF13
    • FGF13_HUMAN
    • FGF2
    • FHF 2
    • FHF-2
    • FHF2
    • Fibroblast growth factor 13
    • Fibroblast growth factor homologous factor 2
    • OTTHUMP00000024143
    • OTTHUMP00000024144
    see all
  • Function
    Probably involved in nervous system development and function.
  • Tissue specificity
    Nervous system.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116898 at approximately 52.69kDa and stained with Coomassie Blue.

References

ab116898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up