Recombinant Human FGF18 protein (Tagged) (ab185589)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGEENVDFRIHVENQTRARDDVSRKQ LRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKG KETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYV GFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRI RPTHPA
    • Molecular weight
      24 kDa including tags
    • Amino acids
      28 to 207
    • Additional sequence information
      Mature protein constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab185589 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and sucrose

General Info

  • Alternative names
    • FGF 18
    • FGF-18
    • Fgf18
    • FGF18_HUMAN
    • FGFI
    • Fibroblast growth factor 18
    • zFGF5
    see all
  • Function
    Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab185589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up