Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGHPIPDSSPLLQFGGQVRQRYLYTD DAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFL CQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSP HRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQG RSPSYAS
    • Molecular weight
      22 kDa including tags
    • Amino acids
      29 to 209
    • Additional sequence information
      Mature protein constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • FGF 21
    • FGF-21
    • Fgf21
    • FGF21_HUMAN
    • FGFL
    • Fibroblast growth factor 21
    • PRO10196
    • UNQ3115
    see all
  • Function
    Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab185602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up