Recombinant Human FGFBP2 protein (ab164458)

Overview

  • Product name
    Recombinant Human FGFBP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSL GQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELR RLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSL RPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKK KAWEHCWKPFQALCAFLISFFRG
    • Amino acids
      1 to 223
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 37 kDa killer-specific secretory protein
    • FGF-binding protein 2
    • FGF-BP2
    • FGFBP-2
    • FGFBP2
    • FGFP2_HUMAN
    • Fibroblast growth factor-binding protein 2
    • HBp17-related protein
    • HBp17-RP
    • Ksp37
    see all
  • Tissue specificity
    Expressed in serum, peripheral leukocytes and cytotoxic T lymphocytes, but not in granulocytes and monocytes (at protein level).
  • Sequence similarities
    Belongs to the fibroblast growth factor-binding protein family.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab164458 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

I can confirm recombinant Human FGFBP2 protein (ab164458) contains a GST tag in N-terminus.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up