Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVR GWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDP KSHRDPSNRHSYPQQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      31 to 145

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 334
    • CD334
    • CD334 antigen
    • fc13h 10
    • fc13h10
    • Fgfr 4
    • FGFR-4
    • Fgfr4
    • FGFR4_HUMAN
    • Fibroblast growth factor receptor 4
    • Hydroxyaryl protein kinase
    • JTK 2
    • JTK2
    • MGC20292
    • Protein tyrosine kinase
    • TKF
    • Tyrosine kinase related to fibroblast growth factor receptor
    • Tyrosylprotein kinase
    see all
  • Function
    Receptor for acidic fibroblast growth factor. Does not bind to basic fibroblast growth factor. Binds FGF19.
  • Tissue specificity
    Expressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated on tyrosine residue (By similarity). Phosphorylation requires the presence of a functional (phosphorylated) FGFR1 and not necessarily by means of FGFR heterodimerization.
  • Cellular localization
    Membrane. Isoform 2 may be secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152386 stained with Coomassie Blue.

References

ab152386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up