Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGS RLAPAGRVRGWRGRLEIASFLPEDAGRYLLARGSMIVLQNLTLITGDSLT SSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRC PAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTY TCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCK VYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRN VSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTAAAPEARYTD
    • Molecular weight
      40 kDa including tags
    • Amino acids
      22 to 369
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit FGF acidic-dependent proliferation of NR6R3T3 mouse fibroblast cells. The ED50 for this effect is typically 6-20 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    ab167751 is lyophilised from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names
    • CD 334
    • CD334
    • CD334 antigen
    • fc13h 10
    • fc13h10
    • Fgfr 4
    • FGFR-4
    • Fgfr4
    • FGFR4_HUMAN
    • Fibroblast growth factor receptor 4
    • Hydroxyaryl protein kinase
    • JTK 2
    • JTK2
    • MGC20292
    • Protein tyrosine kinase
    • TKF
    • Tyrosine kinase related to fibroblast growth factor receptor
    • Tyrosylprotein kinase
    see all
  • Function
    Receptor for acidic fibroblast growth factor. Does not bind to basic fibroblast growth factor. Binds FGF19.
  • Tissue specificity
    Expressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated on tyrosine residue (By similarity). Phosphorylation requires the presence of a functional (phosphorylated) FGFR1 and not necessarily by means of FGFR heterodimerization.
  • Cellular localization
    Membrane. Isoform 2 may be secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167751 stained overnight with Coomassie Blue.

References

ab167751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up