Overview

  • Product name
    Recombinant Human FGL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDE NTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGG GWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQE DYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGN FHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNG VYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
    • Amino acids
      19 to 312
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FGL 1
    • Fgl1
    • FGL1_HUMAN
    • Fibrinogen like 1
    • Fibrinogen like protein 1
    • Fibrinogen related protein 1
    • Fibrinogen-like protein 1
    • Hepassocin
    • Hepatocellular carcinoma related sequence
    • Hepatocyte derived fibrinogen related protein 1
    • Hepatocyte-derived fibrinogen-related protein 1
    • HFREP 1
    • HFREP-1
    • HFREP1
    • HP 041
    • HP-041
    • HP041
    • LFIRE 1
    • LFIRE-1
    • LFIRE1
    • Liver fibrinogen related protein 1
    • Liver fibrinogen-related protein 1
    • MFIRE 1
    • MGC108569
    • MGC12455
    • MGC37822
    • OTTHUMP00000122468
    see all
  • Function
    Has hepatocyte mitogenic activity.
  • Tissue specificity
    Liver specific.
  • Sequence similarities
    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158442 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up