Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13642
    • SpeciesHuman
    • SequenceDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCL HPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGT
    • Molecular weight36 kDa
    • Amino acids23 to 120
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • bA535K18.1
    • FHL 1
    • FHL 1B
    • FHL-1
    • FHL1
    • FHL1 protein
    • FHL1_HUMAN
    • FHL1A
    • FHL1B
    • FLH1A
    • Four and a half LIM domains 1
    • Four and a half LIM domains protein 1
    • Four and a half Lin11 Isl 1 and Mec 3 domains 1
    • four-and-a-half Lin11
    • Isl-1 and Mec-3
    • KYO T
    • KYOT, mouse, homolog of
    • LIM protein SLIMMER
    • MGC111107
    • RAM14-1
    • RBMX1A
    • RBMX1B
    • RBP associated molecule 14-1
    • RP11-535K18.1
    • Skeletal muscle LIM protein 1
    • Skeletal muscle LIM-protein 1
    • SLIM
    • SLIM 1
    • SLIM-1
    • SLIM1
    • SLIMMER
    • XMPMA
    see all
  • FunctionMay have an involvement in muscle development or hypertrophy.
  • Tissue specificityIsoform 1 is highly expressed in skeletal muscle and to a lesser extent in heart, placenta, ovary, prostate, testis, small intestine, colon and spleen. Expression is barely detectable in brain, lung, liver, kidney, pancreas, thymus and peripheral blood leukocytes. Isoform 2 is expressed in brain, skeletal muscle and to a lesser extent in heart, colon, prostate and small intestine. Isoform 3 is expressed in testis, heart and skeletal muscle.
  • Involvement in diseaseDefects in FHL1 are the cause of X-linked dominant scapuloperoneal myopathy (SPM) [MIM:300695]. Scapuloperoneal syndrome (SPS) was initially described more than 120 years ago by Jules Broussard as 'une forme hereditaire d'atrophie musculaire progressive' beginning in the lower legs and affecting the shoulder region earlier and more severely than distal arm. The etiology of this condition remains unclear.
    Defects in FHL1 are the cause of X-linked myopathy with postural muscle atrophy (XMPMA) [MIM:300696]. Myopathies are inherited muscle disorders characterized by weakness and atrophy of voluntary skeletal muscle, and several types of myopathy also show involvement of cardiac muscle. XMPMA is a distinct form of adult-onset X-linked recessive myopathy with several features in common with other myopathies, but the presentation of a pseudoathletic phenotype, scapuloperoneal weakness, and bent spine is unique and might render the clinical phenotype distinguishable from other myopathies.
    Defects in FHL1 are the cause of X-linked severe early-onset reducing body myopathy (RBM) [MIM:300717]. RBM is a rare muscle disorder causing progressive muscular weakness and characteristic intracytoplasmic inclusions in myofibers. Clinical presentations of RBM have ranged from early onset fatal to childhood onset to adult onset cases.
    Defects in FHL1 are the cause of X-linked childhood-onset reducing body myopathy (CO-RBM) [MIM:300718]. This disorder is allelic to severe early-onset reducing body myopathy (RBM) [MIM:300717].
  • Sequence similaritiesContains 3 LIM zinc-binding domains.
  • Developmental stageElevated levels during postnatal muscle growth.
  • Cellular localizationCytoplasm; Cytoplasm. Nucleus and Nucleus. Cytoplasm > cytosol. Predominantly nuclear in myoblasts but is cytosolic in differentiated myotubes.
  • Information by UniProt

Recombinant Human FHL1 protein images

  • ab112286 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human FHL1 protein (ab112286)

ab112286 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"