Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAA VLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFD EAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEE MRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFA FCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLH KSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLV EKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGC LLRLYHD
    • Molecular weight
      41 kDa
    • Amino acids
      1 to 357

Specifications

Our Abpromise guarantee covers the use of ab173021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.6% Tris

    Supplied as a 0.2 µm Ø filtered solution.

General Info

  • Alternative names
    • Acidic fibroblast growth factor intracellular-binding protein
    • aFGF intracellular-binding protein
    • FGF-1 intracellular-binding protein
    • FGFIBP
    • FIBP
    • FIBP-1
    • FIBP_HUMAN
    • FIBP1
    • fibroblast growth factor (acidic) intracellular binding protein
    • OTTHUMP00000234231
    • OTTHUMP00000234232
    • OTTHUMP00000234233
    see all
  • Function
    May be involved in mitogenic function of FGF1.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
  • Cellular localization
    Nucleus. Endomembrane system. Also associated with cytoplasmic membranes, particularly of mitochondria.
  • Information by UniProt

References

ab173021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up