Recombinant Human Fibrillarin protein (ab99443)

Overview

  • Product nameRecombinant Human Fibrillarin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP22087
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHRSMGKNVMVEPHRHEGVFICRGKEDALVTK NLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKP GAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTN IIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGH FVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVV VGVYRPPPKVKN
    • Molecular weight29 kDa including tags
    • Amino acids83 to 321
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 85 % SDS-PAGE.
    ab99443 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 34 kD nucleolar scleroderma antigen
    • 34 kDa nucleolar scleroderma antigen
    • Fbl
    • FBRL_HUMAN
    • FIB
    • FIB1
    • FLRN
    • Histone-glutamine methyltransferase
    • Nop1p
    • RNA U3 small nucleolar interacting protein 1
    • RNU3IP1
    • rRNA 2' O methyltransferase fibrillarin
    • rRNA 2'-O-methyltransferase fibrillarin
    see all
  • FunctionS-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus (PubMed:24352239).
  • Sequence similaritiesBelongs to the methyltransferase superfamily. Fibrillarin family.
  • Post-translational
    modifications
    By homology to other fibrillarins, some or all of the N-terminal domain arginines are modified to asymmetric dimethylarginine (DMA).
  • Cellular localizationNucleus, nucleolus. Fibrillar region of the nucleolus.
  • Information by UniProt

Recombinant Human Fibrillarin protein images

  • 15% SDS-PAGE showing ab99443 at approximately 28.9kDa (3µg).

References for Recombinant Human Fibrillarin protein (ab99443)

ab99443 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"