Recombinant Human Fibromodulin protein (ab152392)

Overview

  • Product name
    Recombinant Human Fibromodulin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQWISLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETY EPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYL PFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKV FSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLE NLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLY MEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVADVVNFSKLQVLRL DGNEIKRSAMPADAPLCLRLASLIEI
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 376

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen binding 59 kDa protein
    • Collagen-binding 59 kDa protein
    • Fibromodulin
    • Fibromodulin precursor
    • Fibromodulin proteoglycan
    • FM
    • FMOD
    • FMOD_HUMAN
    • Keratan sulfate proteoglycan fibromodulin
    • KSPG fibromodulin
    • SLRR2E
    see all
  • Function
    Affects the rate of fibrils formation. May have a primary role in collagen fibrillogenesis.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications
    Binds keratan sulfate chains.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152392 stained with Coomassie Blue.

References

ab152392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

The expression system of the recombinant protein ab152392 was cell-free protein synthesis system (in vitro wheat germ protein expression system.)

Glycosylation and other natural eukaryotic modifications of synthesized protein do not take place...

Read More

Thank you for contacting us.

The tag is GST.

The GST tag should not interfering with the binding assay.

You can order directly from our website. Please change the country form top right corner of the webpage and order it.
Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up