Recombinant Human Fibulin 2 protein (ab114844)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGN EEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKM HIFFTTFAL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1076 to 1184

Specifications

Our Abpromise guarantee covers the use of ab114844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fbln2
    • FBLN2_HUMAN
    • FIBL-2
    • Fibulin-2
    • OTTHUMP00000216670
    • OTTHUMP00000216671
    • OTTHUMP00000216672
    see all
  • Function
    Its binding to fibronectin and some other ligands is calcium dependent.
  • Tissue specificity
    Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
  • Sequence similarities
    Belongs to the fibulin family.
    Contains 3 anaphylatoxin-like domains.
    Contains 11 EGF-like domains.
  • Developmental stage
    Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human Fibulin 2 protein images

  • ab114844 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Fibulin 2 protein (ab114844)

ab114844 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up