Recombinant Human Fibulin 2 protein (ab114844)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP98095
    • SpeciesHuman
    • SequenceFLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGN EEGYFGTRRLNAYTGVVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKM HIFFTTFAL
    • Molecular weight38 kDa including tags
    • Amino acids1076 to 1184

Specifications

Our Abpromise guarantee covers the use of ab114844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fbln2
    • FBLN2_HUMAN
    • FIBL-2
    • Fibulin-2
    • OTTHUMP00000216670
    • OTTHUMP00000216671
    • OTTHUMP00000216672
    see all
  • FunctionIts binding to fibronectin and some other ligands is calcium dependent.
  • Tissue specificityComponent of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
  • Sequence similaritiesBelongs to the fibulin family.
    Contains 3 anaphylatoxin-like domains.
    Contains 11 EGF-like domains.
  • Developmental stageWidely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.
  • Cellular localizationSecreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human Fibulin 2 protein images

  • ab114844 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Fibulin 2 protein (ab114844)

ab114844 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"