Recombinant Human Filensin protein (ab157960)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYENECECQLLLKEMLERLNKEADEALLHNLRLQLEAQFLQDDISAAKDR HKKNLLEVQTYISILQQIIHTTPPASIVTSGMREEKLLTEREVAALRSQL EEGREVLSHLQAQRVELQAQTTTLEQAIKSAHECYDDEIQLYNEQIETLR KEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFI ETPIPLFTQSHGVSLSTGSGGKDLTRALQDITAAKPRQKALPKNVPRRKE IITKDKTNGALEDAPLKGLEDTKLVQVVLKEESESKFESESKEVSPLTQE GAPEDVPDGGQISKGFGKLYRKVKEKVRSPKEPETPTELYTKERHVLVTG DANYVDPRFYVSSITAKGGVAVSVAEDSVLYDGQVGPSPESPKPPLENGQ VGLQEKEDGQPIDQQPIDKEIEPDGAELEGPEEKREGEERDEESRRPCAM VTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVV ESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKSS
    • Amino acids
      1 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beaded filament structural protein 1
    • Beaded filament structural protein 1 filensin
    • BFSP1
    • BFSP1_HUMAN
    • CP115
    • CP94
    • CP95
    • Cytoskeletal protein, 115 KD
    • Filensin
    • Lens fiber cell beaded filament structural protein CP 115
    • Lens fiber cell beaded-filament structural protein CP 115
    • Lens intermediate filament like heavy
    • Lens intermediate filament-like heavy
    • LIFL H
    • LIFL-H
    see all
  • Tissue specificity
    Lens.
  • Involvement in disease
    Defects in BFSP1 are the cause of cataract cortical juvenile-onset (CCJO) [MIM:611391]. A juvenile-onset cataract with opacities restricted to the cortex of the lens, not involving the nucleus.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Cellular localization
    Membrane. Cytoplasm. Cytoplasm > cytoskeleton. Membrane- and cytoskeleton-associated.
  • Information by UniProt

Images

  • ab157960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up