Overview

  • Product name
    Recombinant Human FIP3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAF SESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILE
    • Amino acids
      655 to 754
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EF hands containing Rab interacting protein
    • Eferin
    • Rab11 family interacting protein 3
    • RAB11FIP3
    • RFIP3
    see all
  • Relevance
    FIP3 (RAB11FIP3) is one of many proteins that interact with and regulate Rab GTPases. Forms an heterooligomeric complex with RAB11FIP4. Binds to RAB11A, RAB11B and RAB25.
  • Cellular localization
    Recycling endosome membrane; Peripheral membrane protein. Cytoplasm > cytoskeleton > centrosome. Cleavage furrow. Midbody.

Images

  • ab160628 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up