Overview

  • Product name
    Recombinant Human FJX1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRP ARSGGPAPAPRFPLPPPLAWDARGGSLKTFRALLTLAAGADGPPRQSRSE PRWHVSARQPRPEESAAVHGGVFWSRGLEEQVPPGFSEAQAAAWLEAARG ARMVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARL LGLQRHVPPLALARVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLT DVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTA NFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVA GMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFP ELAALADPHAQLLQRRLDFLAKHILHCKAKYGRRSGT
    • Amino acids
      1 to 437
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FJX1 four jointed box 1 Drosophila
    • FLJ22416
    • FLJ25593
    • Four jointed box 1
    • Four jointed box 1 Drosophila
    • Four jointed protein homolog
    • Putative secreted ligand homologous to FJX1
    see all
  • Relevance
    FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of this gene in humans is not known.
  • Cellular localization
    Secreted

Images

  • ab161773 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up