Recombinant human Calstabin-2 protein (ab113596)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies, MS
Description
-
Product name
Recombinant human Calstabin-2 protein -
Biological activity
Specific activity is > 800nmol/min/mg, and is defined as the amount of enzyme cleaves 1nmole of suc-AAPF-pNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.
-
Purity
> 90 % SDS-PAGE.
ab113596 was purified using conventional chromatography. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHRSMGVEIETISPGDGRTFPKKGQTCVVHYT GMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCT PDVAYGATGHPGVIPPNATLIFDVELLNLE -
Predicted molecular weight
14 kDa including tags -
Amino acids
1 to 108 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab113596 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Additional notes
This product was previously labelled as FKBP1B
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- 12.6 kDa FK506-binding protein
- 12.6 kDa FKBP
- Calstabin 2
see all -
Function
Associates with the ryanodine receptor (RYR-2) in cardiac muscle sarcoplasmic reticulum and may play a unique physiological role in excitation-contraction coupling in cardiac muscle. There are four molecules of FKBP12.6 per heart muscle RYR. Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. -
Tissue specificity
Isoform 1 and isoform 2 are Ubiquitous with highest levels in brain and thymus. -
Sequence similarities
Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
Contains 1 PPIase FKBP-type domain. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab113596 has not yet been referenced specifically in any publications.