Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK IPGGATLVFEVELLKIERRTEL

Associated products

Specifications

Our Abpromise guarantee covers the use of ab93681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant FKBP2 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 90 % SDS-PAGE.
    ab93681 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 13 kDa FK506-binding protein
    • 13 kDa FKBP
    • EC 5.2.1.8
    • FK506 binding protein 2 (13kD)
    • FK506 binding protein 2 13kDa
    • FK506-binding protein 2
    • FK506-binding protein, T-cell, 13-KD
    • FKBP 13
    • FKBP 2
    • FKBP-13
    • FKBP-2
    • FKBP13
    • FKBP2
    • FKBP2_HUMAN
    • Immunophilin FKBP13
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP2
    • PPIase
    • PPIase FKBP2
    • Proline isomerase
    • Rapamycin binding protein
    • Rotamase
    see all
  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificityT-cells and thymus.
  • Sequence similaritiesBelongs to the FKBP-type PPIase family. FKBP2 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant human FKBP2 protein images

  • 15% SDS-PAGE analysis of ab93681 (3µg).

References for Recombinant human FKBP2 protein (ab93681)

ab93681 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab93681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"