Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK IPGGATLVFEVELLKIERRTEL

Associated products

Specifications

Our Abpromise guarantee covers the use of ab93681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant FKBP2 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % SDS-PAGE.
    ab93681 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 13 kDa FK506-binding protein
    • 13 kDa FKBP
    • EC 5.2.1.8
    • FK506 binding protein 2 (13kD)
    • FK506 binding protein 2 13kDa
    • FK506-binding protein 2
    • FK506-binding protein, T-cell, 13-KD
    • FKBP 13
    • FKBP 2
    • FKBP-13
    • FKBP-2
    • FKBP13
    • FKBP2
    • FKBP2_HUMAN
    • Immunophilin FKBP13
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP2
    • PPIase
    • PPIase FKBP2
    • Proline isomerase
    • Rapamycin binding protein
    • Rotamase
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity
    T-cells and thymus.
  • Sequence similarities
    Belongs to the FKBP-type PPIase family. FKBP2 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab93681 (3µg).

References

ab93681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab93681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up