Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILG NGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFT LG DCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAA LCLE VTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAA NSYDLA IKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYR AALRSCSL VLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEP SNKTIHAELS KLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWS IPWKWLFGATAV ALGGVALSVVIAARN
    • Amino acids
      49 to 413

Specifications

Our Abpromise guarantee covers the use of ab93970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitution with 95 µl aqua dest.

General Info

  • Alternative names
    • 38 kDa FK506-binding protein
    • 38 kDa FKBP
    • 38kDa
    • FK506 binding protein 8
    • FK506 binding protein 8, 38kDa
    • FK506 binding protein, 38kDa
    • FK506-binding protein 8
    • FKBP 38
    • FKBP-38
    • FKBP-8
    • Fkbp8
    • FKBP8_HUMAN
    • FKBPR38
    • hFKBP38
    • Peptidyl-prolyl cis-trans isomerase FKBP8
    • PPIase FKBP8
    • Rotamase
    • Sam11
    see all
  • Function
    Constitutively inactive PPiase, which becomes active when bound to calmodulin and calcium. Seems to act as a chaperone for BCL2, targets it to the mitochondria and modulates its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex probably interferes with the binding of BCL2 to its targets. The active form of FKBP8 may therefore play a role in the regulation of apoptosis.
  • Tissue specificity
    Widely expressed. Highest levels seen in the brain.
  • Sequence similarities
    Contains 1 PPIase FKBP-type domain.
    Contains 3 TPR repeats.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Recombinant Human FKBP38 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 46 kDa (purple). The protein-specific band is blue.

References for Recombinant Human FKBP38 protein (ab93970)

ab93970 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab93970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up