Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13451
    • SpeciesHuman
    • SequenceMTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIG DKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKG EICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPI GIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSF EKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKE HNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE EKPEGHV
    • Molecular weight76 kDa including tags
    • Amino acids1 to 457

Specifications

Our Abpromise guarantee covers the use of ab114430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 51 kDa FK506 binding protein
    • 51 kDa FK506 binding protein 5
    • 51 kDa FK506-binding protein
    • 51 kDa FKBP
    • 54 kDa progesterone receptor associated immunophilin
    • 54 kDa progesterone receptor-associated immunophilin
    • AIG 6
    • AIG6
    • Androgen regulated protein 6
    • Androgen-regulated protein 6
    • FF1 antigen
    • FK506 binding protein 5
    • FK506-binding protein 5
    • FKBP 5
    • FKBP 51
    • FKBP 54
    • FKBP-5
    • FKBP-51
    • FKBP5
    • FKBP5_HUMAN
    • FKBP54
    • HSP90 binding immunophilin
    • HSP90-binding immunophilin
    • MGC111006
    • OTTHUMP00000016268
    • P54
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP5
    • Peptidylprolyl cis trans isomerase
    • PPIase
    • PPIase FKBP5
    • Ptg 10
    • Ptg10
    • Rotamase
    • T cell FK506 binding protein
    see all
  • FunctionInteracts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP.
  • Tissue specificityWidely expressed, enriched in testis compared to other tissues.
  • Sequence similaritiesContains 2 PPIase FKBP-type domains.
    Contains 3 TPR repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human FKBP51 protein images

  • ab114430 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human FKBP51 protein (ab114430)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab114430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"