Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGGSALNQGVLEGDDAPGQSLYERLSQRML DISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKT PRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPN TTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYL KLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES
    • Molecular weight
      39 kDa including tags
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab95497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 190 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant FKBP6 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab95497 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 36 kDa FK506 binding protein
    • 36 kDa FK506-binding protein
    • 36 kDa FKBP
    • EC 5.2.1.8
    • FK506 binding protein 6
    • FK506-binding protein 6
    • FKBP 36
    • FKBP-36
    • FKBP-6
    • FKBP36
    • fkbp6
    • FKBP6_HUMAN
    • Immunophilin FKBP36
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP6
    • PPIase
    • PPIase FKBP6
    • Rotamase
    see all
  • Function
    PPIases accelerate the folding of proteins.
  • Tissue specificity
    Detected in all tissues examined, with higher expression in testis, heart, skeletal muscle, liver, and kidney.
  • Involvement in disease
    Note=FKBP6 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of FKBP6 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities
    Contains 1 PPIase FKBP-type domain.
    Contains 3 TPR repeats.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab95497 at approximately 39.3kDa (3µg).

References

ab95497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab95497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up