Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75344
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGGSALNQGVLEGDDAPGQSLYERLSQRML DISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKT PRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPN TTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYL KLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES
    • Molecular weight39 kDa including tags
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab95497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 190 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant FKBP6 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab95497 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 36 kDa FK506 binding protein
    • 36 kDa FK506-binding protein
    • 36 kDa FKBP
    • EC 5.2.1.8
    • FK506 binding protein 6
    • FK506-binding protein 6
    • FKBP 36
    • FKBP-36
    • FKBP-6
    • FKBP36
    • fkbp6
    • FKBP6_HUMAN
    • Immunophilin FKBP36
    • Peptidyl prolyl cis trans isomerase
    • Peptidyl-prolyl cis-trans isomerase FKBP6
    • PPIase
    • PPIase FKBP6
    • Rotamase
    see all
  • FunctionPPIases accelerate the folding of proteins.
  • Tissue specificityDetected in all tissues examined, with higher expression in testis, heart, skeletal muscle, liver, and kidney.
  • Involvement in diseaseNote=FKBP6 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of FKBP6 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similaritiesContains 1 PPIase FKBP-type domain.
    Contains 3 TPR repeats.
  • Information by UniProt

Recombinant human FKBP6 protein images

  • 15% SDS-PAGE showing ab95497 at approximately 39.3kDa (3µg).

References for Recombinant human FKBP6 protein (ab95497)

ab95497 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab95497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"