Recombinant Human FKSG14 protein (ab163779)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKES KNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFSE
    • Amino acids
      64 to 155
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF5 alpha
    • AF5alpha
    • B130045K24Rik
    • BB232189
    • C530004N04Rik
    • CENP K
    • CENPK
    • Centromere protein K
    • Centromeric protein K
    • FKSG 14
    • FKSG14
    • ICEN 37
    • ICEN37
    • Interphase centromere complex protein 37
    • Leucine zipper protein FKSG14
    • OTTHUMP00000161888
    • P33
    • Protein AF 5alpha
    • Protein AF5alpha
    • Solt
    • Solzt
    • SoxLZ/Sox6 binding protein Solt
    • SoxLZ/Sox6 leucine zipper binding protein
    see all
  • Relevance
    FKSG14, also known as CENPK (centromere protein K) is a component of the CENPA-CAD (nucleosome distal) complex. It may be involved in incorporation of CENPA into centromeres and is required for proper kinetochore function, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with CASC5/KNL1 to recruit the NDC80 complex to the outer kinetochore. FKSG14 constitutively localized to centromeres throughout the cell cycle. There are 3 isoforms produced by alternative splicing.
  • Cellular localization
    Nuclear. Centromere. Kinetochore. Localizes exclusively in the centromeres.

Images

  • ab163779 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up