Recombinant Human FLIP protein (denatured) (ab111628)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15519
    • SpeciesHuman
    • SequenceMSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKL SVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEI GEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLD LLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNN FRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKP LGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAG KPKMFFIQNYVVSEGQLENSSLLEVDGPAMKNVEFKAQKRGLCTVHREAD FFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYM YDWNSRVSAKEKYYVWLQHTLRKKLILSYT
    • Molecular weight55 kDa
    • Amino acids1 to 480

Specifications

Our Abpromise guarantee covers the use of ab111628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.
    ab111628 was denatured using detergent during a conventional chromatography purification process.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • c FLIP
    • c FLIPL
    • c FLIPR
    • c FLIPS
    • c-FLIP
    • c-FLIPL
    • c-FLIPR
    • c-FLIPS
    • CASH
    • CASP8 and FADD like apoptosis regulator
    • CASP8 and FADD-like apoptosis regulator subunit p12
    • CASP8AP1
    • Caspase homolog
    • Caspase like apoptosis regulatory protein
    • Caspase related inducer of apoptosis
    • Caspase-eight-related protein
    • Caspase-like apoptosis regulatory protein
    • Casper
    • Cellular FLICE-like inhibitory protein
    • CFLA
    • Cflar
    • CFLAR_HUMAN
    • CLARP
    • FADD like anti apoptotic molecule
    • FADD-like antiapoptotic molecule 1
    • FLAME
    • FLAME-1
    • FLAME1
    • FLIP
    • I FLICE
    • I-FLICE
    • Inhibitor of FLICE
    • MACH-related inducer of toxicity
    • MRIT
    • OTTHUMP00000163715
    • OTTHUMP00000206475
    • OTTHUMP00000206476
    • OTTHUMP00000206478
    • OTTHUMP00000206479
    • OTTHUMP00000206480
    • OTTHUMP00000206482
    • OTTHUMP00000207360
    • Usurpin
    • Usurpin beta
    see all
  • FunctionApoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.
  • Tissue specificityWidely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.
  • Sequence similaritiesBelongs to the peptidase C14A family.
    Contains 2 DED (death effector) domains.
  • DomainThe caspase domain lacks the active sites residues involved in catalysis.
  • Post-translational
    modifications
    Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12.
  • Information by UniProt

Recombinant Human FLIP protein (denatured) images

  • 15% SDS-PAGE showing ab111628 at approximately 55.3kDa (3µg).

References for Recombinant Human FLIP protein (denatured) (ab111628)

ab111628 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"