Recombinant Human FLJ22167 protein (ab164039)

Overview

  • Product name
    Recombinant Human FLJ22167 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWL KRSSYEEQPTVRFQHQVLLVALLGPESDGFLAWSTFPAFNRLQGDRLRVP LVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILTFSYRLHRMAT LVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVING TSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIR YPVEVISYQPGFWEMVKFAWVQYVSILLIFLWVFERIKIFVFQNQVVTTI PVTVTPRGDLCKEHLS
    • Amino acids
      1 to 316
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALYE870
    • CDNA: FLJ22167 fis, clone HRC00584
    • hCG 2043031
    • HCG2043031, isoform CRA a
    • hypothetical protein LOC79583
    • JBTS20
    • PRO1886
    • Putative uncharacterized protein FLJ22167
    • Q9H6L2
    • TM231_HUMAN
    • Tmem231
    • Transmembrane protein 231
    • UNQ870/PRO1886
    • UPF0513 membrane protein
    see all
  • Function
    Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.
  • Involvement in disease
    Defects in TMEM231 are the cause of Joubert syndrome 20 (JBTS20) [MIM:614970]. A disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease.
  • Sequence similarities
    Belongs to the TMEM231 family.
  • Cellular localization
    Cell projection > cilium membrane. Localizes to the transition zone of primary cilia; SEPT2 is required for localization to the transition zone.
  • Information by UniProt

Images

  • ab164039 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up