Recombinant Human FLJ22655 protein (ab164111)

Overview

  • Product name
    Recombinant Human FLJ22655 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERK QLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIY RIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFC ELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGK RRKSV
    • Amino acids
      1 to 205
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Clone HSI07590
    • Hypothetical protein FLJ22655
    • Hypothetical protein LOC79785
    • Putative uncharacterized protein FLJ22655
    • Ras related and estrogen-regulated growth inhibitor like protein
    • RERG/Ras like
    • RERG/Ras like protein
    • RERGL
    see all
  • Relevance
    FLJ22655 is a hypothetical protein and it belongs to the small GTPase superfamily, Ras family. It binds GDP/GTP and may possess intrinsic GTPase activity.

Images

  • ab164111 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up