Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVID STTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQ DLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARI PLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTL EELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNL TELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLD LSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVV NVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHA SATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADS IRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPK STYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAS LPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDY MESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKAT HTIGYGTTRGYRDGGIPDIDYSYT
    • Amino acids
      1 to 674
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fibronectin-like domain containing leucine rich transmembrane protein 1
    • Fibronectin-like domain-containing leucine-rich transmembrane protein 1
    • FLRT1
    • FLRT1_HUMAN
    • Leucine rich repeat transmembrane protein FLRT1
    • Leucine-rich repeat transmembrane protein FLRT1
    see all
  • Function
    Plays a role in fibroblast growth factor-mediated signaling cascades that lead to the activation of MAP kinases. Promotes neurite outgrowth via FGFR1-mediated activation of downstream MAP kinases. Promotes an increase both in neurite number and in neurite length. May play a role in cell-cell adhesion and cell guidance via its interaction with ADGRL1/LPHN1 and ADGRL3.
  • Tissue specificity
    Expressed in kidney and brain.
  • Sequence similarities
    Contains 1 fibronectin type-III domain.
    Contains 10 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications
    N-glycosylated.
    Phosphorylated in response to FGFR1 signaling, but is not a direct substrate of FGFR1 or SRC. A mutant where the Tyr phosphorylation sites have been replaced by Phe displays constitutive FGFR1-dependent activation of downstream MAP kinases.
    Proteolytic cleavage in the juxtamembrane region gives rise to a soluble ectodomain.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle membrane. Cytoplasm, perinuclear region. Cell junction, focal adhesion. Secreted. Cell projection. Cell junction. In addition to its location at the cell membrane, colocalizes with FGFR1 in punctate perinuclear cytoplasmic vesicles. Detected along neurites and at contacts between neurite termini and other cells. Proteolytic cleavage gives rise to a shedded ectodomain.
  • Information by UniProt

Images

  • ab161763 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up