Recombinant human Flt3 ligand protein (ab83996)

Overview

Description

  • NatureRecombinant
  • SourceBarley
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQ DEELCGGLWRLVLAQRWMERL KTVAGSKMQGLLERVNTEIHFVTKCAF QPPPSCLRFVQTNISRLLQETSEQLVALKPWITR QNFSRCLELQCQPD SSTLPPPWSPRPLEATAPTAPAS
    • Amino acids27 to 184

Specifications

Our Abpromise guarantee covers the use of ab83996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity: The ED50 of ab83996 is typically between 0.5 -5.0 ng/ml as measured in a cell proliferation assay using the OCI/AML5 Human leukemia cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • FunctionStimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant human Flt3 ligand protein images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References for Recombinant human Flt3 ligand protein (ab83996)

ab83996 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"