Recombinant human Flt3 ligand protein (Animal Free) (ab179623)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWR LVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQT NISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLE ATAPT
    • Molecular weight
      18 kDa
    • Amino acids
      27 to 180
    • Additional sequence information
      Extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab179623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    OCI-AML5 cell proliferation: ED50 ≤10ng/ml; ≥ 1.0 x 105 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Endotoxin level
    <=1.000 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.
    Also determined by HPCL and spectroscopy at 280 nm.
  • Form
    Lyophilised
  • Additional notes

    This product is produced with no animal-derived raw products, animal free equipment and animal free protocols.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.16% Sodium phosphate, 0.29% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.

General Info

  • Alternative names
    • FL
    • Flt 3 ligand
    • Flt 3L
    • Flt3 L
    • FLT3 LG
    • Flt3 ligand
    • Flt3L
    • FLT3L_HUMAN
    • Flt3lg
    • Fms related tyrosine kinase 3 ligand
    • Fms-related tyrosine kinase 3 ligand
    • SL cytokine
    see all
  • Function
    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

References

ab179623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up