Overview

  • Product name
    Recombinant Human FMO1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEG RASLYKSVVSNSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDL LKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFL TNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIA VEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTP IVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQA SLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLP PPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLF SMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIK ARVVQESPSPFESFLKVFSFLALLVAIFLIFL
    • Amino acids
      1 to 532
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dimethylaniline monooxygenase [N oxide forming] 1
    • Dimethylaniline monooxygenase [N-oxide-forming] 1
    • Dimethylaniline oxidase 1
    • Fetal hepatic flavin containing monooxygenase 1
    • Fetal hepatic flavin-containing monooxygenase 1
    • Flavin Containing Monooxygenase 1
    • Flavin containing monooxygenase 1 (fetal liver)
    • FMO 1
    • FMO1
    • FMO1_HUMAN
    • OTTHUMP00000033536
    • OTTHUMP00000033537
    see all
  • Function
    This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
  • Tissue specificity
    Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.
  • Sequence similarities
    Belongs to the FMO family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab158455 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up