Overview

  • Product name
    Recombinant Human FMO2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDG RASIYQSVVTNTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDL LKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVFDAVMVCSGHH ILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIA VELSKNAAQVFISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRT AVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAIKVK STVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLP SERTMMMDIIKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFC SLLFKDPKLAVRLYFGPCNSY
    • Amino acids
      1 to 471
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310008D08Rik
    • 2310042I22Rik
    • AW107733
    • Dimethylaniline monooxygenase [N oxide forming] 2
    • Dimethylaniline monooxygenase [N-oxide-forming] 2
    • Dimethylaniline oxidase 2
    • Flavin containing monooxygenase 2
    • Flavin containing monooxygenase 2 (non functional)
    • FLJ40826
    • FMO
    • FMO 1B1
    • FMO 2
    • FMO pulmonary
    • FMO1B1
    • FMO2
    • FMO2_HUMAN
    • MGC28212
    • OTTMUSP00000028686
    • OTTMUSP00000028687
    • Pulmonary flavin containing monooxygenase 2
    • Pulmonary flavin-containing monooxygenase 2
    see all
  • Function
    Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.
  • Tissue specificity
    Expressed in lung (at protein level). Expressed predominantly in lung, and at a much lesser extent in kidney. Also expressed in fetal lung, but not in liver, kidney and brain.
  • Sequence similarities
    Belongs to the FMO family.
  • Post-translational
    modifications
    The truncated form is probably unable to fold correctly and is rapidly degraded.
    FMO2*1 is sumoylated at 'Lys-492'.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab158456 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up