Overview

  • Product name
    Recombinant Human FMO3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG RASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNL LKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHH VYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIA TELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTA ISDWLYMKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLP SMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWL FLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTR VVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
    • Molecular weight
      87 kDa including tags
    • Amino acids
      1 to 532

Specifications

Our Abpromise guarantee covers the use of ab152391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Purity
    81 % Proprietary Purification.

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dimethylaniline monooxygenase [N oxide forming] 3
    • Dimethylaniline monooxygenase [N-oxide-forming] 3
    • Dimethylaniline monooxygenase 3
    • Dimethylaniline oxidase 3
    • dJ127D3.1
    • Flavin containing monooxygenase 3
    • FMO 3
    • FMO form 2
    • FMO II
    • FMO3
    • FMO3_HUMAN
    • FMOII
    • Hepatic flavin containing monooxygenase 3
    • Hepatic flavin-containing monooxygenase 3
    • MGC34400
    • TMAU
    • Trimethylamine monooxygenase
    see all
  • Function
    Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds.
  • Tissue specificity
    Liver.
  • Involvement in disease
    Defects in FMO3 are the cause of trimethylaminuria (TMAU) [MIM:602079]; also known as fish-odor syndrome. TMAU is an inborn error of metabolism associated with an offensive body odor and caused by deficiency of FMO-mediated N-oxidation of amino-trimethylamine (TMA) derived from foodstuffs. Such individuals excrete relatively large amounts of TMA in their urine, sweat, and breath, and exhibit a fishy body odor characteristic of the malodorous free amine.
  • Sequence similarities
    Belongs to the FMO family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152391 stained with Coomassie Blue.

References

ab152391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up