Recombinant Human FMRFamide protein (ab152897)

Overview

  • Product name
    Recombinant Human FMRFamide protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQ TSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGL NSQFWSLAAPQRFGKK
    • Molecular weight
      39 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab152897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FMFRamide related peptide precursor
    • FMRFAL
    • FMRFamide related peptides precursor
    • Neuropeptide FF amide peptide precursor
    • NPFF
    • NPFF protein
    see all
  • Relevance
    FMRFamide related peptides are morphine modulating peptides that have many physiologic effects, including the modulation of morphine induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ACCN2 and ACCN3 channels.
  • Cellular localization
    Secreted

Images

  • 12.5% SDS-PAGE analysis of ab152897 stained with Coomassie Blue.

References

ab152897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up