Recombinant Human FNBP1L protein (ab162869)

Overview

  • Product name
    Recombinant Human FNBP1L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTI KLSECYRGFADSERK
    • Amino acids
      175 to 239
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1orf39
    • FBP1L_HUMAN
    • FNBP 1L
    • fnbp1l
    • Formin binding protein 1 like
    • Formin-binding protein 1-like
    • TOCA 1
    • Toca-1
    • TOCA1
    • Transducer of Cdc42 dependent actin assembly 1
    • Transducer of Cdc42 dependent actin assembly protein 1
    • Transducer of Cdc42-dependent actin assembly protein 1
    see all
  • Function
    Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. May bind to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promote membrane invagination and the formation of tubules. Also promotes CDC42-induced actin polymerization by activating the WASL/N-WASP-WASPIP/WIP complex, the predominant form of WASL/N-WASP in cells. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles.
  • Sequence similarities
    Belongs to the FNBP1 family.
    Contains 1 FCH domain.
    Contains 1 REM (Hr1) repeat.
    Contains 1 SH3 domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Cytoplasmic vesicle. Cell membrane.
  • Information by UniProt

Images

  • ab162869 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up