Overview

  • Product name
    Recombinant Human FOG1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPS PALTLLLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGL LSVLLTAEPH
    • Amino acids
      86 to 195
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FOG-1
    • FOG1_HUMAN
    • Friend of GATA 1
    • Friend of GATA protein 1
    • Friend of GATA1
    • ZFPM1
    • Zinc finger protein
    • Zinc finger protein 89A
    • Zinc finger protein multitype 1
    • Zinc finger protein ZFPM1
    see all
  • Function
    Transcription regulator that plays an essential role in erythroid and megakaryocytic cell differentiation. Essential cofactor that acts via the formation of a heterodimer with transcription factors of the GATA family GATA1, GATA2 and GATA3. Such heterodimer can both activate or repress transcriptional activity, depending on the cell and promoter context. The heterodimer formed with GATA proteins is essential to activate expression of genes such as NFE2, ITGA2B, alpha- and beta-globin, while it represses expression of KLF1. May be involved in regulation of some genes in gonads. May also be involved in cardiac development, in a non-redundant way with ZFPM2/FOG2.
  • Tissue specificity
    Mainly expressed in hematopoietic tissues. Also expressed in adult cerebellum, stomach, lymph node, liver and pancreas. Expressed in fetal heart, liver and spleen.
  • Sequence similarities
    Belongs to the FOG (Friend of GATA) family.
    Contains 4 C2H2-type zinc fingers.
    Contains 5 C2HC-type zinc fingers.
  • Domain
    The CCHC-type zinc fingers 1, 5, 6 and 9 directly bind to GATA-type zinc fingers. The Tyr residue adjacent to the last Cys of the CCHC-type zinc finger is essential for the interaction with GATA-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165738 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up