Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK MEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL
    • Molecular weight
      36 kDa
    • Amino acids
      36 to 128

Specifications

Our Abpromise guarantee covers the use of ab114615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114615 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • beta hFR
    • FBP
    • FBP/PL 1
    • FBP2
    • fetal/placental
    • Folate receptor
    • Folate receptor 2
    • folate receptor 2 (fetal)
    • Folate receptor beta
    • Folate receptor, fetal/placental
    • Folbp 2
    • Folbp2
    • Folr2
    • FOLR2_HUMAN
    • FR beta
    • FR P3
    • FR-beta
    • Placental folate binding protein
    • Placental folate-binding protein
    see all
  • Function
    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells.
  • Tissue specificity
    Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
  • Sequence similarities
    Belongs to the folate receptor family.
  • Post-translational
    modifications
    Eight disulfide bonds are present.
    N-glycosylated.
  • Cellular localization
    Cell membrane. Secreted.
  • Information by UniProt

Images

  • ab114615 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up