Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14207
    • SpeciesHuman
    • SequenceHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK MEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL
    • Molecular weight36 kDa
    • Amino acids36 to 128

Specifications

Our Abpromise guarantee covers the use of ab114615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114615 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • beta hFR
    • FBP
    • FBP/PL 1
    • FBP2
    • fetal/placental
    • Folate receptor
    • Folate receptor 2
    • folate receptor 2 (fetal)
    • Folate receptor beta
    • Folate receptor, fetal/placental
    • Folbp 2
    • Folbp2
    • Folr2
    • FOLR2_HUMAN
    • FR beta
    • FR P3
    • FR-beta
    • Placental folate binding protein
    • Placental folate-binding protein
    see all
  • FunctionBinds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells.
  • Tissue specificityExpressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.
  • Sequence similaritiesBelongs to the folate receptor family.
  • Post-translational
    modifications
    Eight disulfide bonds are present.
    N-glycosylated.
  • Cellular localizationCell membrane. Secreted.
  • Information by UniProt

Recombinant Human FOLR2 protein images

  • ab114615 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human FOLR2 protein (ab114615)

ab114615 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"