Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESE IAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKED
    • Molecular weight
      37 kDa including tags
    • Amino acids
      151 to 250

Specifications

Our Abpromise guarantee covers the use of ab152397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator protein 1
    • AP 1
    • DKFZp686C0818
    • FBJ murine osteosarcoma viral oncogene homolog B
    • fosB
    • FOSB_HUMAN
    • G0/G1 switch regulatory protein 3
    • G0S3
    • GOS 3
    • GOS B
    • GOS3
    • GOSB
    • MGC42291
    • Oncogene FOS B
    • Oncogene FOSB
    • Protein fos B
    • Protein fosB
    see all
  • Function
    FosB interacts with Jun proteins enhancing their DNA binding activity.
  • Sequence similarities
    Belongs to the bZIP family. Fos subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152397 stained with Coomassie Blue.

References

ab152397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up