Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPAL APVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
    • Molecular weight
      35 kDa including tags
    • Amino acids
      411 to 494

Specifications

Our Abpromise guarantee covers the use of ab114922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Drosphilia Forkhead Homolog Like 17
    • FKHL 17
    • Forkhead box protein D2
    • Forkhead Related Activator 9
    • Forkhead-related protein FKHL17
    • Forkhead-related transcription factor 9
    • FOXD2
    • FOXD2_HUMAN
    • FREAC 9
    • FREAC-9
    see all
  • Function
    Probable transcription factor involved in embryogenesis and somatogenesis.
  • Tissue specificity
    Kidney specific.
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human FOXD2 protein images

  • 12.5% SDS-PAGE showing ab114922 at approximately 34.87kDa.
    Stained with Coomassie Blue.

References for Recombinant Human FOXD2 protein (ab114922)

ab114922 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up