Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPAL APVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
    • Molecular weight
      35 kDa including tags
    • Amino acids
      411 to 494

Specifications

Our Abpromise guarantee covers the use of ab114922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Drosphilia Forkhead Homolog Like 17
    • FKHL 17
    • Forkhead box protein D2
    • Forkhead Related Activator 9
    • Forkhead-related protein FKHL17
    • Forkhead-related transcription factor 9
    • FOXD2
    • FOXD2_HUMAN
    • FREAC 9
    • FREAC-9
    see all
  • Function
    Probable transcription factor involved in embryogenesis and somatogenesis.
  • Tissue specificity
    Kidney specific.
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114922 at approximately 34.87kDa.
    Stained with Coomassie Blue.

References

ab114922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up