Overview

  • Product name
    Recombinant Human FOXL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGK QGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQ
    • Amino acids
      221 to 319
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKH 6
    • FKH6
    • FKHL 11
    • FKHL11
    • Forkhead (Drosophila) like 11
    • Forkhead box L1
    • Forkhead box protein L1
    • Forkhead related protein FKHL11
    • Forkhead related transcription factor 7
    • Forkhead-related protein FKHL11
    • Forkhead-related transcription factor 7
    • FOX L1
    • FOXL 1
    • Foxl1
    • FOXL1_HUMAN
    • FREAC 7
    • FREAC-7
    • FREAC7
    see all
  • Sequence similarities
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158446 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up