Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQE LAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAM YIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIG TTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQ QDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDA YGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVV LNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTS CIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAH SFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSC LDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKN KSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM
    • Amino acids
      1 to 594
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FPGT
    • FPGT_HUMAN
    • Fucose 1 phosphate guanyltransferase
    • Fucose 1 phosphate guanylyltransferase
    • Fucose-1-phosphate guanylyltransferase
    • GDP beta L fucose pyrophosphorylase
    • GDP L fucose diphosphorylase
    • GDP L fucose pyrophosphorylase
    • GDP-L-fucose diphosphorylase
    • GDP-L-fucose pyrophosphorylase
    • GFPP
    see all
  • Function
    Catalyzes the formation of GDP-L-fucose from GTP and L-fucose-1-phosphate. Functions as a salvage pathway to reutilize L-fucose arising from the turnover of glycoproteins and glycolipids.
  • Tissue specificity
    Expressed in many tissues.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160188 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up