Overview

  • Product name
    Recombinant Human FPRL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
    • Molecular weight
      30 kDa including tags
    • Amino acids
      163 to 205

Specifications

Our Abpromise guarantee covers the use of ab114357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALXR
    • FMLP-R-I
    • FMLP-R-II
    • FMLP-related receptor I
    • FMLPX
    • Formyl peptide receptor 2
    • Formyl peptide receptor related
    • Formyl peptide receptor-like 1
    • FPR2
    • FPR2_HUMAN
    • FPR2A
    • FPRH1
    • FPRH2
    • FPRL1
    • HM63
    • Lipoxin A4 receptor
    • LXA4 receptor
    • LXA4R
    • N-formyl peptide receptor 2
    • RFP
    see all
  • Function
    Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4).
  • Tissue specificity
    Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114357 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up