Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY GEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      207 to 296

Specifications

Our Abpromise guarantee covers the use of ab152398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ23306
    • Fos L2
    • FOS like antigen 2
    • Fos related antigen 2
    • Fos-related antigen 2
    • FosL 2
    • Fosl2
    • FOSL2_HUMAN
    • FRA 2
    • FRA-2
    see all
  • Function
    Controls osteoclast survival and size (By similarity). As a dimer with JUN, activates LIF transcription (By similarity). Activates CEBPB transcription in PGE2-activated osteoblasts.
  • Sequence similarities
    Belongs to the bZIP family. Fos subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152398 stained with Coomassie Blue.

References

ab152398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up