Recombinant Human Fragilis protein (ab92921)

Overview

  • Product name
    Recombinant Human Fragilis protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 133

Specifications

Our Abpromise guarantee covers the use of ab92921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, PBS, pH 7.4

General Info

  • Alternative names
    • 1 8U
    • Fragilis
    • IFITM3
    • IFM3_HUMAN
    • Interferon Induced Transmembrane Protein 3
    • Interferon induced transmembrane protein 3 (1 8U)
    • Interferon inducible
    • Interferon inducible protein 1 8U
    • Interferon Inducible Protein 15
    • Interferon Inducible Protein Homolog
    • Interferon-induced transmembrane protein 3
    • Interferon-inducible protein 1-8U
    • IP15
    see all
  • Function
    IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus (WNV), by inhibiting the early step(s) of replication.
  • Sequence similarities
    Belongs to the CD225 family.
  • Post-translational
    modifications
    Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab92921 on 10% SDS-PAGE stained with Coomassie Blue. Predicted band size is 43 kDa.
  • Anti-Fragilis antibody [EPR5242] (ab109429) at 1/1000 dilution + Recombinant Human Fragilis protein (ab92921) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References

ab92921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up