Recombinant Human Fragilis protein (ab92921)

Overview

  • Product nameRecombinant Human Fragilis protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ01628
    • SpeciesHuman
    • SequenceMNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG
    • Molecular weight43 kDa including tags
    • Amino acids1 to 133

Specifications

Our Abpromise guarantee covers the use of ab92921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, PBS, pH 7.4

General Info

  • Alternative names
    • 1 8U
    • Fragilis
    • IFITM3
    • IFM3_HUMAN
    • Interferon Induced Transmembrane Protein 3
    • Interferon induced transmembrane protein 3 (1 8U)
    • Interferon inducible
    • Interferon inducible protein 1 8U
    • Interferon Inducible Protein 15
    • Interferon Inducible Protein Homolog
    • Interferon-induced transmembrane protein 3
    • Interferon-inducible protein 1-8U
    • IP15
    see all
  • FunctionIFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus (WNV), by inhibiting the early step(s) of replication.
  • Sequence similaritiesBelongs to the CD225 family.
  • Post-translational
    modifications
    Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Fragilis protein images

  • ab92921 on 10% SDS-PAGE stained with Coomassie Blue. Predicted band size is 43 kDa.
  • Anti-Fragilis antibody [EPR5242] (ab109429) at 1/1000 dilution + Recombinant Human Fragilis protein (ab92921) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 10 seconds

References for Recombinant Human Fragilis protein (ab92921)

ab92921 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"