Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTV TNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQFTAV KLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEPVFQNGKMALL ASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKG NVKQCEINYVKKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAK LKADRYCK
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • frg1
    • FRG1_HUMAN
    • FRG1A
    • FSG1
    • FSHD region gene 1 protein
    • Protein FRG1
    see all
  • Function
    May have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits. May be involved in pre-mRNA splicing.
  • Tissue specificity
    Expressed in adult muscle, lymphocytes, fetal brain, muscle, and placenta.
  • Sequence similarities
    Belongs to the FRG1 family.
  • Cellular localization
    Nucleus > Cajal body. Nucleus speckle. Nucleus > nucleolus. First expressed in Cajal bodies and nuclear speckles. As speckle expression diminishes, expression is seen in dense structures (dense fibrillar component and the granular component) of the nucleolus.
  • Information by UniProt

Images

  • ab158466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up