Recombinant Human FZD10 protein (Fc Chimera) (ab198679)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human FZD10 protein (Fc Chimera)
See all FZD10 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHE FAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGIEGRMDPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK -
Predicted molecular weight
43 kDa including tags -
Amino acids
21 to 161 -
Additional sequence information
Recombinant fragment of human Frizzled 10 (amino acids 21-161) fused at C terminal with Fc portion of Human IgG1 (amino acids 100-330).
-
Specifications
Our Abpromise guarantee covers the use of ab198679 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
This product was previously labelled as Frizzled 10
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.48% Tris, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol (glycerin, glycerine)
Sterile-filtered (0.2 µm)
General Info
-
Alternative names
- CD 350
- CD 350 antigen
- CD350
see all -
Function
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. -
Tissue specificity
Highest levels in the placenta and fetal kidney, followed by fetal lung and brain. In adult brain, abundantly expressed in the cerebellum, followed by cerebral cortex, medulla and spinal cord; very low levels in total brain, frontal lobe, temporal lobe and putamen. Weak expression detected in adult brain, heart, lung, skeletal muscle, pancreas, spleen and prostate. -
Sequence similarities
Belongs to the G-protein coupled receptor Fz/Smo family.
Contains 1 FZ (frizzled) domain. -
Domain
Lys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
The FZ domain is involved in binding with Wnt ligands. -
Post-translational
modificationsUbiquitinated by ZNRF3, leading to its degradation by the proteasome. -
Cellular localization
Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab198679 has not yet been referenced specifically in any publications.